bokun.io 68 C
🛡️ SEO 75 🤖 GEO 73 ⚡ Perf 47 🏗️ Arch 71

bokun.io — Global SEODiff Score 68/100

bokun.io
📊

With a solid 78/100 ACRI, bokun.io is well-positioned for AI search — better than 89% of sites in the Radar. Compared to other infrastructure sites (avg score: 57), bokun.io performs above the benchmark, suggesting strong competitive positioning in AI search. Server-side rendering keeps the ghost ratio near zero, giving AI systems direct access to all visible content. The 11.3× token bloat ratio falls within the normal range, though there is room to trim navigation, footer, and script overhead. Only 1 schema block is present — adding Organization, WebSite, and Breadcrumb schemas would significantly improve structured data coverage. The site maintains an open-door policy for AI crawlers — GPTBot, ClaudeBot, and other major agents are all allowed.

68
C — Global SEODiff Score
Comprehensive search visibility assessment
Strong foundations, but Performance (47) is your bottleneck.
🎯 Top Fix: Add HSTS header → +2 pts
🔬 Automated SEODiff Assessment · Snapshot: Feb 26, 2026 · 📋 API
Does your site score higher than bokun.io?
Run the same 40-signal audit on your own domain — free, instant results.
Scan Your Site Free →
🧮 Score Transparency — How is this calculated?
🛡️ Traditional SEO (25% weight)75 × 0.25 = 18.8
🤖 AI Readiness / GEO (40% weight)73 × 0.40 = 29.2
⚡ Performance (20% weight)47 × 0.20 = 9.4
🏗️ Architecture & Trust (15% weight)71 × 0.15 = 10.7
Weighted sum = 18.8 + 29.2 + 9.4 + 10.7
Global SEODiff Score = 68 (C)
📊 ACRI Sub-Scores (AI Readiness Detail)
100
Bot Access
avg 92
100
Rendering
avg 93
39
Structure
avg 35
42
Schema
avg 10
85
Tech Stack
avg 64
🔀
Visibility Delta: Google vs AI
Google (Tranco)
Top 7%
Rank #66310
Aligned
Gap
AI (ACRI)
Top 11%
Score 78/100

bokun.io has balanced Google and AI visibility — both rank roughly in the same tier. ACRI measures technical crawler readiness. Read the methodology →

Why bokun.io ranks here

Tech stackWordPress
RenderingSSR
Schema coverage1 blocks
Token bloat11.3×

Fastest improvements

  • Reduce token bloat (navigation/footer/code) so agents reach your main content faster (see Token Bloat).
  • Create an llms.txt file so AI crawlers can discover your content structure without heavy crawling. Generate llms.txt →
  • Run a full entropy audit to find which DOM regions waste the most tokens. Run Entropy Audit →
🧪

JavaScript Rendering Check

We check what AI crawlers miss when they skip JavaScript execution.

Running headless browser to simulate AI extraction…
🛡️

Traditional SEO

75/100 25 % of Global Score 🟢 High Confidence

📝 Title Tag

65 chars
Too long

Optimal range: 30–60 characters for SERP display.

📋 Meta Description

146 chars
Good length

Optimal range: 120–160 characters for snippet control.

🔤 Heading Hierarchy

  • ✓ Exactly 1 <h1> tag — found 1
  • ✓ Has <h2> headings — found 26
  • ✓ <h2> not before <h1>

🔍 Indexability

  • ✓ Canonical tag present → https://www.bokun.io/
  • ✓ No noindex directive
  • ✓ Meta viewport set
  • ✓ HTML lang attribute → en-GB
  • ✗ Hreflang tags
  • ✓ Googlebot allowed by robots.txt

🌐 Social / OpenGraph

  • ✓ og:title — Bókun: Booking management software for tour & activity providers
  • ✓ og:description — The all-in-one platform from Tripadvisor built to help you stay organised and get more bookings with thousands of connections to OTAs & resellers.
  • ✓ og:image — preview
  • ✓ twitter:card — summary_large_image
📐 How the SEO Pillar score is calculated

SEO Pillar = Title (20 pts) + Meta Desc (20 pts) + Heading Hierarchy (20 pts) + Indexability (20 pts) + Social/OG (20 pts)

Each sub-score is derived from the checks above. Canonical tag, lang attribute, og:image, and a single H1 are the highest-impact items.

🤖

AI Readiness / GEO

73/100 40 % of Global Score 🟢 High Confidence

This pillar aggregates citation share, hallucination risk, bot access, schema health, and content extractability. The individual diagnostic sections below contribute to this score.

🔗

Citation Alternatives

Research
💡
Insight: In the infrastructure sector, safely.co.jp (ACRI: 90) currently has stronger AI extractability. AI models tend to prefer sources with higher semantic structure and schema coverage. Domains with ACRI < 40 see 3.5× more hallucinations. Read the research →
bokun.io
58
Your ACRI Score
90
Industry Peer ACRI
AI models prioritize pages with strong semantic structure and schema coverage. safely.co.jp has schema coverage of 3 blocks and uses WordPress. Improve your score by implementing the remediation patches below.
📊 Side-by-Side Comparison →
🚨

Hallucination Risk

Research

Is AI lying about your brand? This panel measures how likely LLMs are to hallucinate facts when extracting information from your page.

Analyzing hallucination risk…

🤖 Bot Access Matrix

GPTBot (OpenAI)
Allowed
ClaudeBot (Anthropic)
Allowed
CCBot (Common Crawl)
Allowed
Google-Extended
Allowed
Googlebot
Allowed

👻 Rendering (Ghost Ratio) Docs

Ghost Ratio 0%
0% — Safe 50% 100% — Risk
Status Server-Side Rendered (Safe)
Rendering Type SSR

📊 Structure & Information Density Docs

Structure Grade 39/100 — Low
Structured Elements 71 elements (71 lists, 0 rows, 0 headers)
Total Words1518
Raw Density4.7%
💡Low structure score (39/100). Your content appears as a wall of text with few structured HTML elements. You have 71 list items, 0 table rows, 0 table headers. Convert features into <ul> lists and data into <table> elements to help AI models extract structured information.

🏷️ Schema Health Docs

Organization Schema ✅ Present
Product / Service Schema ⚠️ Not Found
Total Schema Blocks1 block(s) — Basic (low value for AI)

Schema Coverage Map

3/7 schema types detected
✅ Organization
❌ Product/Service
✅ Breadcrumb
❌ FAQ
❌ Article
✅ WebSite
💡Product / Service schema missing. AI models don't know this is a SaaS product. Add Product or SoftwareApplication schema so AI understands what you offer and can surface pricing/features.
💡FAQ schema missing. Adding FAQPage schema lets AI models directly extract Q&A pairs for Featured Snippets and chatbot answers.

📐 AI Efficiency Metrics Docs

56
AI Extractability
Medium
Crawl Cost
None
Blocklist Risk
Extractability56/100 — AI models can partially extract answers from this page
Crawl CostMedium (50/100) — moderate for AI crawlers to process
Blocklist RiskNone — 0 of 5 AI crawlers blocked

Token Bloat Research

8%
🗑️ 92%
Useful Content (42.8 KB)Bloat (439.0 KB)
Token Bloat Ratio11.3× — Normal

Multimodal Readiness

Visual Context30% Optimized for Vision
Image Alt Coverage11 / 37 images have alt text

TDM Rights

TDM-Reservation HeaderNot set
X-Robots-Tag: noaiNot set
💡Only 30% of images have alt text. Add descriptive alt attributes so multimodal AI (ChatGPT Vision) can understand your images.

🔥 Structural Entropy Check Research

0 Entropy
Poor Token Bloat: High
Noise Ratio: 91.1% · SNR: 0.10 · Signal: 10955 / Noise: 112380 tokens

🔬 AI-Crawler Simulation

See your website the way AI crawlers do. CSS stripped, structure labeled, content chunked.

🌐
This is what humans see — styled, branded, visual.
Toggle to "AI Agent View" to see what GPTBot, ClaudeBot, and other AI crawlers actually extract from this page.
🤖

AI Answer Preview

NEW

See how AI models summarize your site. Left: your actual content. Right: what the LLM extracts and says about you.

Simulating AI extraction…

🔧 Tech Stack

FrameworkWordPress
AI-Readiness Score85/100
Servercloudflare
CDNcloudflare
HTTP Status200
Load Time1052 ms
Raw HTML Size481.8 KB
Visible Text Size42.8 KB

Performance & Speed

47/100 20 % of Global Score 🟢 High Confidence

⏱️ Time to First Byte

1052 ms
Slow — bots may time out or deprioritise

Google considers <200 ms "good". AI crawlers may have even shorter timeouts.

📦 Page Weight

1134
DOM nodes
482 KB
HTML payload
Heavy page — consider reducing DOM complexity

🗄️ Cache & CDN

  • ✓ Cache-Control header → public, max-age=0, s-maxage=86400
  • ✓ CDN cache status → HIT
  • ✓ CDN detected → cloudflare

🔬 Tracker Tax

0
tracker scripts
0
third-party domains
0.0%
token overhead
Minimal tracker load — clean signal for bots
📐 How the Performance Pillar score is calculated

Perf Pillar = TTFB (35 pts) + Page Weight (25 pts) + Cache/CDN (20 pts) + Tracker Tax (20 pts)

TTFB <200 ms = full marks. DOM >3000 or payload >300 KB incurs heavy penalties. Tracker scripts beyond 5 reduce score.

🏗️

Architecture & Trust

71/100 15 % of Global Score 🟢 High Confidence

🗺️ Sitemap & Robots

  • ✓ Sitemap declared in robots.txt → https://www.bokun.io/sitemap_index.xml
  • ✓ Googlebot allowed
  • ✓ GPTBot allowed
  • ✓ ClaudeBot allowed

🔗 Linking

114
internal links
6
external links
Good internal linking — helps crawlers discover content

🔒 Security & Trust

  • ✗ HSTS header (Strict-Transport-Security)
  • ✗ Content-Security-Policy header
  • ✓ HTTP status 200 OK (got 200)

♿ Accessibility Signals

  • ✓ HTML lang attribute → en-GB
  • ✓ Meta viewport for mobile
  • ✓ Single H1 for screen readers
📐 How the Architecture Pillar score is calculated

Arch Pillar = Sitemap & Robots (30 pts) + Linking (25 pts) + Security (25 pts) + Accessibility (20 pts)

Having a valid sitemap, allowing AI bots, HSTS, and a good internal link count are the highest-impact items.

🏅 AI-Verified Trust Badge

Your site scores 58/100. Reach 80+ to unlock the green "AI-Verified" badge. Fix the issues below to improve your score.

AI-Verified badge for bokun.io
Pending Audit — score below 80 threshold
<a href="https://seodiff.io/radar/domains/bokun.io" rel="noopener"><img src="https://seodiff.io/api/v1/badge?domain=bokun.io" alt="AI-Verified by SEODiff" width="280" height="52"></a>

💡 Paste in your site footer, GitHub README, or email signature. Badge updates automatically as your score changes.

🔗 Similar infrastructure Sites

Domains with a similar tech stack, industry, and AI readiness profile to bokun.io. Compare side-by-side.

Domain ACRI AI Score Tech Stack Token Bloat Schema
bokun.io (this site) 58 78 WordPress 11.3× 1
rackhosting.com 58 73 WordPress 11.3× 1 Compare →
bokuntest.com 58 78 WordPress 11.3× 1 Compare →
actividadesdeinfantilyprimaria.com 58 77 WordPress 11.3× 1 Compare →
stairwell.com 58 78 WordPress 11.3× 1 Compare →
newsstatix.com 58 76 WordPress 11.3× 1 Compare →
Compare All 5 Similar Sites →
🩹

Remediation Patches

COPY-PASTE

Auto-generated code fixes tailored to bokun.io. Copy and paste these into your codebase to improve AI visibility. These patches are mathematically proven to increase extraction accuracy →

Reduce Token Bloat
Medium Impact ⏱ 1–2 hrs
Only 8% of your HTML is useful content. AI crawlers waste context window tokens on bloat.
html
<!-- Move inline CSS to external stylesheets -->
<link rel="stylesheet" href="/css/main.css">

<!-- Move inline scripts to external files with defer -->
<script src="/js/app.js" defer></script>

<!-- Remove duplicate navigation blocks -->
<!-- Keep only ONE <nav> in the <header> -->

<!-- Ensure <main> wraps your primary content -->
<main>
  <!-- Your content here — this is what AI sees first -->
</main>
Add FAQ Schema
Medium Impact ⏱ 10 min
FAQ schema lets AI models directly extract Q&A pairs. This is the easiest way to get featured in AI responses.
html
<script type="application/ld+json">
{
  "@context": "https://schema.org",
  "@type": "FAQPage",
  "mainEntity": [
    {
      "@type": "Question",
      "name": "What is Bokun?",
      "acceptedAnswer": {
        "@type": "Answer",
        "text": "Add your answer here — describe what Bokun does in 1-2 sentences."
      }
    },
    {
      "@type": "Question",
      "name": "How does Bokun work?",
      "acceptedAnswer": {
        "@type": "Answer",
        "text": "Explain the key features and how users interact with Bokun."
      }
    }
  ]
}
</script>
📈

Projected Impact

ROI EST.

If you apply the patches above, here's the estimated improvement for bokun.io:

Current Score
78
Projected Score
86
Improvement
+8 pts
Reduce token bloat +5 pts
Add FAQ schema +3 pts

*Estimates based on SEODiff's scoring model. Actual results depend on implementation quality.

📋 Data Export

Download scores and metadata for audits, client reports, or CI/CD pipelines. Exports contain computed metrics only (no copyrighted content).

All data is generated automatically and updated with each crawl. JSON exports contain scores and metadata only (no copyrighted content).

Is this your company?

Monitor your AI visibility score weekly and get alerted when changes happen.

Start Free →

🧭 Self-Diffing (Private Layer)

For owned domains, combine this world snapshot with private drift + regression history.
Template Drift
Track in My Site
Drift → Traffic Impact
In development coming soon
Regression Incidents
Track in My Site
Internal Linking
Deep Audit graph
Semantic Structure
GEO view in Deep Audit
Content Quality
Thin/duplicate tracking

🕒 History

Score over timeAvailable in My Site history
Drift eventsTemplate timeline + incidents
Drift → Revenue AttributionComing soon
Schema/rendering/extractability changesTracked per scan in project history