workplacefinancialservices.schwab.com 45 D
🛡️ SEO 31 🤖 GEO 49 ⚡ Perf 68 🏗️ Arch 25

workplacefinancialservices.schwab.com — Global SEODiff Score 45/100

workplacefinancialservices.schwab.com
📊

workplacefinancialservices.schwab.com struggles with AI visibility, recording a critical ACRI of 18/100 — AI crawlers face significant hurdles extracting its content. Compared to other finance sites (avg score: 57), workplacefinancialservices.schwab.com is trailing the benchmark, indicating room for competitive improvement. Content is delivered server-side, meaning bots and AI agents can parse the full page without executing JavaScript. With a 1.6× bloat ratio, the page delivers its content without excessive boilerplate, giving AI systems a clean extraction path. No structured data was detected, which means AI systems must infer all entities and relationships from raw HTML alone. Robots.txt grants unrestricted access to the key AI user-agents, which is the strongest starting position for AI visibility.

45
D — Global SEODiff Score
Comprehensive search visibility assessment
Below average — Architecture (25) has the most room for improvement.
🎯 Top Fix: Add Organization + WebSite JSON-LD → +5–8 pts
🔬 Automated SEODiff Assessment · Snapshot: Mar 20, 2026 · 📋 API
📈 ACRI Trend 2 snapshots
Mar 10 Mar 20
🔔 Recent AI Indexing Activity
No recent changes detected by adaptive crawler.
Does your site score higher than workplacefinancialservices.schwab.com?
Run the same 40-signal audit on your own domain — free, instant results.
Scan Your Site Free →
🧮 Score Transparency — How is this calculated?
🛡️ Traditional SEO (25% weight)31 × 0.25 = 7.8
🤖 AI Readiness / GEO (40% weight)49 × 0.40 = 19.6
⚡ Performance (20% weight)68 × 0.20 = 13.6
🏗️ Architecture & Trust (15% weight)25 × 0.15 = 3.8
Weighted sum = 7.8 + 19.6 + 13.6 + 3.8
Global SEODiff Score = 45 (D)
📊 ACRI Sub-Scores (AI Readiness Detail)
100
Bot Access
avg 92
99
Rendering
avg 93
0
Structure
avg 35
0
Schema
avg 9
50
Tech Stack
avg 63

Why workplacefinancialservices.schwab.com ranks here

Tech stackCustom / Proprietary
Industryfinance
RenderingSSR
Schema coverage0 blocks
Token bloat1.6×

Fastest improvements

  • Add basic Organization and WebSite JSON-LD to fix “0 schema blocks” (see Schema Coverage).
  • Create an llms.txt file so AI crawlers can discover your content structure without heavy crawling. Generate llms.txt →
  • Run a full entropy audit to find which DOM regions waste the most tokens. Run Entropy Audit →
🧪

JavaScript Rendering Check

We check what AI crawlers miss when they skip JavaScript execution.

Running headless browser to simulate AI extraction…
🛡️

Traditional SEO

31/100 25 % of Global Score 🟡 Medium Confidence

📝 Title Tag

13 chars
Too short

Optimal range: 30–60 characters for SERP display.

📋 Meta Description

0 chars
Missing

Optimal range: 120–160 characters for snippet control.

🔤 Heading Hierarchy

  • ✓ Exactly 1 <h1> tag — found 1
  • ✗ Has <h2> headings — found 0
  • ✓ <h2> not before <h1>

🔍 Indexability

  • ✗ Canonical tag present
  • ✓ No noindex directive
  • ✗ Meta viewport set
  • ✗ HTML lang attribute
  • ✗ Hreflang tags
  • ✓ Googlebot allowed by robots.txt

🌐 Social / OpenGraph

  • ✗ og:title
  • ✗ og:description
  • ✗ og:image
  • ✗ twitter:card
📐 How the SEO Pillar score is calculated

SEO Pillar = Title (20 pts) + Meta Desc (20 pts) + Heading Hierarchy (20 pts) + Indexability (20 pts) + Social/OG (20 pts)

Each sub-score is derived from the checks above. Canonical tag, lang attribute, og:image, and a single H1 are the highest-impact items.

🤖

AI Readiness / GEO

49/100 40 % of Global Score 🟢 High Confidence

This pillar aggregates citation share, hallucination risk, bot access, schema health, and content extractability. The individual diagnostic sections below contribute to this score.

🔗

Citation Alternatives

Research
💡
Insight: In the finance sector, cardpay.com (ACRI: 82) currently has stronger AI extractability. AI models tend to prefer sources with higher semantic structure and schema coverage. Domains with ACRI < 40 see 3.5× more hallucinations. Read the research →
workplacefinancialservices.schwab.com
30
Your ACRI Score
82
Industry Peer ACRI
AI models prioritize pages with strong semantic structure and schema coverage. cardpay.com has schema coverage of 1 blocks and uses WordPress. Improve your score by implementing the remediation patches below.
📊 Side-by-Side Comparison →
🚨

Hallucination Risk

Research

Is AI lying about your brand? This panel measures how likely LLMs are to hallucinate facts when extracting information from your page.

Analyzing hallucination risk…

🤖 Bot Access Matrix

GPTBot (OpenAI)
Allowed
ClaudeBot (Anthropic)
Allowed
CCBot (Common Crawl)
Allowed
Google-Extended
Allowed
Googlebot
Allowed

👻 Rendering (Ghost Ratio) Docs

Ghost Ratio 5%
0% — Safe 50% 100% — Risk
Status Server-Side Rendered (Safe)
Rendering Type SSR

📊 Structure & Information Density Docs

Structure Grade 0/100 — Poor
Structured Elements 0 elements (0 lists, 0 rows, 0 headers)
Total Words17
Raw Density0.0%
💡Low structure score (0/100). Very little extractable text detected (17 words). AI crawlers may be blocked from accessing the real page content — check the Ghost Ratio and Bot Access sections.

🏷️ Schema Health Docs

Organization Schema ❌ Missing
Product / Service Schema ⚠️ Not Found
Total Schema Blocks0 — No JSON-LD detected

Schema Coverage Map

0/7 schema types detected
❌ Organization
❌ Product/Service
❌ Breadcrumb
❌ FAQ
❌ Article
❌ WebSite
💡Organization schema missing. AI models cannot identify your brand entity. Without it, your brand won't appear in Knowledge Panels or be associated with your content.
💡Product / Service schema missing. AI models don't know this is a SaaS product. Add Product or SoftwareApplication schema so AI understands what you offer and can surface pricing/features.
💡BreadcrumbList schema missing. AI cannot understand your site hierarchy or how pages relate to each other.
💡FAQ schema missing. Adding FAQPage schema lets AI models directly extract Q&A pairs for Featured Snippets and chatbot answers.
💡WebSite schema missing. Add WebSite + SearchAction so Google can generate a Sitelinks Search Box for your brand in AI results.

📐 AI Efficiency Metrics Docs

45
AI Extractability
Low
Crawl Cost
None
Blocklist Risk
Extractability45/100 — AI models can partially extract answers from this page
Crawl CostLow (10/100) — efficient for AI crawlers to process
Blocklist RiskNone — 0 of 5 AI crawlers blocked

Token Bloat Research

62%
🗑️ 38%
Useful Content (240 B)Bloat (151 B)
Token Bloat Ratio1.6× — Lean

Multimodal Readiness

Visual ContextNo images detected
Image Alt Coverage0 / 0 images have alt text

TDM Rights

TDM-Reservation HeaderNot set
X-Robots-Tag: noaiNot set

🔥 Structural Entropy Check Research

85 Entropy
Good Token Bloat: Low
Noise Ratio: 38.1% · SNR: 1.62 · Signal: 60 / Noise: 37 tokens

🔬 AI-Crawler Simulation

See your website the way AI crawlers do. CSS stripped, structure labeled, content chunked.

🌐
This is what humans see — styled, branded, visual.
Toggle to "AI Agent View" to see what GPTBot, ClaudeBot, and other AI crawlers actually extract from this page.
🤖

AI Answer Preview

NEW

See how AI models summarize your site. Left: your actual content. Right: what the LLM extracts and says about you.

Simulating AI extraction…

🔧 Tech Stack

AI-Readiness Score50/100
ServerAkamaiGHost
CDNakamai
HTTP Status403
Load Time1956 ms
Raw HTML Size391 B
Visible Text Size240 B

Performance & Speed

68/100 20 % of Global Score 🟢 High Confidence

⏱️ Time to First Byte

1956 ms
Slow — bots may time out or deprioritise

Google considers <200 ms "good". AI crawlers may have even shorter timeouts.

📦 Page Weight

7
DOM nodes
0 KB
HTML payload
Lean page — fast for bots and users

🗄️ Cache & CDN

  • ✓ Cache-Control header → max-age=0
  • ✗ CDN cache status
  • ✓ CDN detected → akamai

🔬 Tracker Tax

0
tracker scripts
0
third-party domains
0.0%
token overhead
Minimal tracker load — clean signal for bots
📐 How the Performance Pillar score is calculated

Perf Pillar = TTFB (35 pts) + Page Weight (25 pts) + Cache/CDN (20 pts) + Tracker Tax (20 pts)

TTFB <200 ms = full marks. DOM >3000 or payload >300 KB incurs heavy penalties. Tracker scripts beyond 5 reduce score.

🏗️

Architecture & Trust

25/100 15 % of Global Score 🔴 Low Confidence

🗺️ Sitemap & Robots

  • ✗ Sitemap declared in robots.txt
  • ✓ Googlebot allowed
  • ✓ GPTBot allowed
  • ✓ ClaudeBot allowed

🔗 Linking

0
internal links
0
external links
Very few internal links — crawlers may miss important pages

🔒 Security & Trust

  • ✗ HSTS header (Strict-Transport-Security)
  • ✗ Content-Security-Policy header
  • ✗ HTTP status 200 OK (got 403)

♿ Accessibility Signals

  • ✗ HTML lang attribute
  • ✗ Meta viewport for mobile
  • ✓ Single H1 for screen readers
📐 How the Architecture Pillar score is calculated

Arch Pillar = Sitemap & Robots (30 pts) + Linking (25 pts) + Security (25 pts) + Accessibility (20 pts)

Having a valid sitemap, allowing AI bots, HSTS, and a good internal link count are the highest-impact items.

🏅 AI-Verified Trust Badge

Your site scores 30/100. Reach 80+ to unlock the green "AI-Verified" badge. Fix the issues below to improve your score.

AI-Verified badge for workplacefinancialservices.schwab.com
Pending Audit — score below 80 threshold
<a href="https://seodiff.io/radar/domains/workplacefinancialservices.schwab.com" rel="noopener"><img src="https://seodiff.io/api/v1/badge?domain=workplacefinancialservices.schwab.com" alt="AI-Verified by SEODiff" width="280" height="52"></a>

💡 Paste in your site footer, GitHub README, or email signature. Badge updates automatically as your score changes.

🔗 Similar finance Sites

Domains with a similar tech stack, industry, and AI readiness profile to workplacefinancialservices.schwab.com. Compare side-by-side.

Domain ACRI AI Score Tech Stack Token Bloat Schema
workplacefinancialservices.schwab.com (this site) 30 18 Custom / Proprietary 1.6× 0
lekiosque.finances.gouv.fr 55 70 Custom / Proprietary 3.9× 0 Compare →
safehaven.com 55 71 Custom / Proprietary 6.2× 0 Compare →
sandstone.com.au 55 74 Custom / Proprietary 6.0× 1 Compare →
siliconinvestor.com 55 72 Custom / Proprietary 8.5× 0 Compare →
ibm.cioreview.com 55 15 Custom / Proprietary 7.5× 1 Compare →
Compare All 5 Similar Sites →

📊 Semantic Share of Voice

How often would an AI cite workplacefinancialservices.schwab.com when users ask about topics in this domain's niche? We run entity queries through our 188k-page search index and measure citation probability.

Analyzing citation landscape…

🩹

Remediation Patches

COPY-PASTE

Auto-generated code fixes tailored to workplacefinancialservices.schwab.com. Copy and paste these into your codebase to improve AI visibility. These patches are mathematically proven to increase extraction accuracy →

Add Organization JSON-LD
High Impact ⏱ 5 min
AI models cannot identify your brand entity without Organization schema. This is the #1 fix for AI visibility.
html
<script type="application/ld+json">
{
  "@context": "https://schema.org",
  "@type": "Organization",
  "name": "Schwab",
  "url": "https://workplacefinancialservices.schwab.com",
  "logo": "https://workplacefinancialservices.schwab.com/logo.png",
  "sameAs": []
}
</script>
Add WebSite + SearchAction JSON-LD
High Impact ⏱ 5 min
Enables the Sitelinks Search Box in Google and allows AI to understand your site structure.
html
<script type="application/ld+json">
{
  "@context": "https://schema.org",
  "@type": "WebSite",
  "name": "Schwab",
  "url": "https://workplacefinancialservices.schwab.com",
  "potentialAction": {
    "@type": "SearchAction",
    "target": "https://workplacefinancialservices.schwab.com/search?q={search_term_string}",
    "query-input": "required name=search_term_string"
  }
}
</script>
📈

Projected Impact

ROI EST.

If you apply the patches above, here's the estimated improvement for workplacefinancialservices.schwab.com:

Current Score
18
Projected Score
28
Improvement
+10 pts
Add Organization schema +6 pts
Add WebSite schema +4 pts

*Estimates based on SEODiff's scoring model. Actual results depend on implementation quality.

📋 Data Export

Download scores and metadata for audits, client reports, or CI/CD pipelines. Exports contain computed metrics only (no copyrighted content).

All data is generated automatically and updated with each crawl. JSON exports contain scores and metadata only (no copyrighted content).

Is this your company?

Monitor your AI visibility score weekly and get alerted when changes happen.

Start Free →

🧭 Self-Diffing (Private Layer)

For owned domains, combine this world snapshot with private drift + regression history.
Template Drift
Track in My Site
Drift → Traffic Impact
In development coming soon
Regression Incidents
Track in My Site
Internal Linking
Deep Audit graph
Semantic Structure
GEO view in Deep Audit
Content Quality
Thin/duplicate tracking

🕒 History

Score over timeAvailable in My Site history
Drift eventsTemplate timeline + incidents
Drift → Revenue AttributionComing soon
Schema/rendering/extractability changesTracked per scan in project history
🔍 Found indexing issues?
Run a free deep audit to diagnose crawled-not-indexed, soft 404s, redirect errors, and more.
Free Deep Audit → GSC Error Guide →