workplacefinancialservices.schwab.com struggles with AI visibility, recording a critical ACRI of 18/100 — AI crawlers face significant hurdles extracting its content. Compared to other finance sites (avg score: 57), workplacefinancialservices.schwab.com is trailing the benchmark, indicating room for competitive improvement. Content is delivered server-side, meaning bots and AI agents can parse the full page without executing JavaScript. With a 1.6× bloat ratio, the page delivers its content without excessive boilerplate, giving AI systems a clean extraction path. No structured data was detected, which means AI systems must infer all entities and relationships from raw HTML alone. Robots.txt grants unrestricted access to the key AI user-agents, which is the strongest starting position for AI visibility.
🧮 Score Transparency — How is this calculated?
📊 ACRI Sub-Scores (AI Readiness Detail)
Why workplacefinancialservices.schwab.com ranks here
Fastest improvements
- Add basic Organization and WebSite JSON-LD to fix “0 schema blocks” (see Schema Coverage).
- Create an
llms.txtfile so AI crawlers can discover your content structure without heavy crawling. Generate llms.txt → - Run a full entropy audit to find which DOM regions waste the most tokens. Run Entropy Audit →
Traditional SEO
31/100 25 % of Global Score 🟡 Medium Confidence📝 Title Tag
Optimal range: 30–60 characters for SERP display.
📋 Meta Description
Optimal range: 120–160 characters for snippet control.
🔤 Heading Hierarchy
- ✓ Exactly 1 <h1> tag — found 1
- ✗ Has <h2> headings — found 0
- ✓ <h2> not before <h1>
🔍 Indexability
- ✗ Canonical tag present
- ✓ No noindex directive
- ✗ Meta viewport set
- ✗ HTML lang attribute
- ✗ Hreflang tags
- ✓ Googlebot allowed by robots.txt
🌐 Social / OpenGraph
- ✗ og:title
- ✗ og:description
- ✗ og:image
- ✗ twitter:card
📐 How the SEO Pillar score is calculated
SEO Pillar = Title (20 pts) + Meta Desc (20 pts) + Heading Hierarchy (20 pts) + Indexability (20 pts) + Social/OG (20 pts)
Each sub-score is derived from the checks above. Canonical tag, lang attribute, og:image, and a single H1 are the highest-impact items.
AI Readiness / GEO
49/100 40 % of Global Score 🟢 High ConfidenceThis pillar aggregates citation share, hallucination risk, bot access, schema health, and content extractability. The individual diagnostic sections below contribute to this score.
Is AI lying about your brand? This panel measures how likely LLMs are to hallucinate facts when extracting information from your page.
🤖 Bot Access Matrix
📊 Structure & Information Density Docs
🏷️ Schema Health Docs
Schema Coverage Map
📐 AI Efficiency Metrics Docs
Token Bloat Research
Multimodal Readiness
TDM Rights
🔥 Structural Entropy Check Research
🔬 AI-Crawler Simulation
See your website the way AI crawlers do. CSS stripped, structure labeled, content chunked.
Toggle to "AI Agent View" to see what GPTBot, ClaudeBot, and other AI crawlers actually extract from this page.
AI Answer Preview
NEWSee how AI models summarize your site. Left: your actual content. Right: what the LLM extracts and says about you.
🔧 Tech Stack
Performance & Speed
68/100 20 % of Global Score 🟢 High Confidence⏱️ Time to First Byte
Google considers <200 ms "good". AI crawlers may have even shorter timeouts.
📦 Page Weight
DOM nodes
HTML payload
🗄️ Cache & CDN
- ✓ Cache-Control header →
max-age=0 - ✗ CDN cache status
- ✓ CDN detected → akamai
🔬 Tracker Tax
tracker scripts
third-party domains
token overhead
📐 How the Performance Pillar score is calculated
Perf Pillar = TTFB (35 pts) + Page Weight (25 pts) + Cache/CDN (20 pts) + Tracker Tax (20 pts)
TTFB <200 ms = full marks. DOM >3000 or payload >300 KB incurs heavy penalties. Tracker scripts beyond 5 reduce score.
Architecture & Trust
25/100 15 % of Global Score 🔴 Low Confidence🗺️ Sitemap & Robots
- ✗ Sitemap declared in robots.txt
- ✓ Googlebot allowed
- ✓ GPTBot allowed
- ✓ ClaudeBot allowed
🔗 Linking
internal links
external links
🔒 Security & Trust
- ✗ HSTS header (Strict-Transport-Security)
- ✗ Content-Security-Policy header
- ✗ HTTP status 200 OK (got 403)
♿ Accessibility Signals
- ✗ HTML lang attribute
- ✗ Meta viewport for mobile
- ✓ Single H1 for screen readers
📐 How the Architecture Pillar score is calculated
Arch Pillar = Sitemap & Robots (30 pts) + Linking (25 pts) + Security (25 pts) + Accessibility (20 pts)
Having a valid sitemap, allowing AI bots, HSTS, and a good internal link count are the highest-impact items.
🏅 AI-Verified Trust Badge
Your site scores 30/100. Reach 80+ to unlock the green "AI-Verified" badge. Fix the issues below to improve your score.
<a href="https://seodiff.io/radar/domains/workplacefinancialservices.schwab.com" rel="noopener"><img src="https://seodiff.io/api/v1/badge?domain=workplacefinancialservices.schwab.com" alt="AI-Verified by SEODiff" width="280" height="52"></a>
💡 Paste in your site footer, GitHub README, or email signature. Badge updates automatically as your score changes.
🔗 Similar finance Sites
Domains with a similar tech stack, industry, and AI readiness profile to workplacefinancialservices.schwab.com. Compare side-by-side.
| Domain | ACRI | AI Score | Tech Stack | Token Bloat | Schema | |
|---|---|---|---|---|---|---|
| workplacefinancialservices.schwab.com (this site) | 30 | 18 | Custom / Proprietary | 1.6× | 0 | — |
| lekiosque.finances.gouv.fr | 55 | 70 | Custom / Proprietary | 3.9× | 0 | Compare → |
| safehaven.com | 55 | 71 | Custom / Proprietary | 6.2× | 0 | Compare → |
| sandstone.com.au | 55 | 74 | Custom / Proprietary | 6.0× | 1 | Compare → |
| siliconinvestor.com | 55 | 72 | Custom / Proprietary | 8.5× | 0 | Compare → |
| ibm.cioreview.com | 55 | 15 | Custom / Proprietary | 7.5× | 1 | Compare → |
📊 Semantic Share of Voice
How often would an AI cite workplacefinancialservices.schwab.com when users ask about topics in this domain's niche? We run entity queries through our 188k-page search index and measure citation probability.
Analyzing citation landscape…
Remediation Patches
COPY-PASTEAuto-generated code fixes tailored to workplacefinancialservices.schwab.com. Copy and paste these into your codebase to improve AI visibility. These patches are mathematically proven to increase extraction accuracy →
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "Organization",
"name": "Schwab",
"url": "https://workplacefinancialservices.schwab.com",
"logo": "https://workplacefinancialservices.schwab.com/logo.png",
"sameAs": []
}
</script>
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "WebSite",
"name": "Schwab",
"url": "https://workplacefinancialservices.schwab.com",
"potentialAction": {
"@type": "SearchAction",
"target": "https://workplacefinancialservices.schwab.com/search?q={search_term_string}",
"query-input": "required name=search_term_string"
}
}
</script>
Projected Impact
ROI EST.If you apply the patches above, here's the estimated improvement for workplacefinancialservices.schwab.com:
*Estimates based on SEODiff's scoring model. Actual results depend on implementation quality.
📋 Data Export
Download scores and metadata for audits, client reports, or CI/CD pipelines. Exports contain computed metrics only (no copyrighted content).
All data is generated automatically and updated with each crawl. JSON exports contain scores and metadata only (no copyrighted content).
Is this your company?
Monitor your AI visibility score weekly and get alerted when changes happen.
Start Free →